| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
| Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
| Protein automated matches [191002] (3 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries) |
| Domain d4ub6j_: 4ub6 J: [261421] Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6u_, d4ub6v_, d4ub6x_, d4ub6z_ automated match to d3arcj_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 4ub6 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub6j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub6j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl
Timeline for d4ub6j_: