Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (28 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1078020] [260068] (2 PDB entries) |
Domain d4u7ja1: 4u7j A:3-172 [260070] Other proteins in same PDB: d4u7ja2, d4u7jb2 automated match to d1j20a1 complexed with cl, edo |
PDB Entry: 4u7j (more details), 1.75 Å
SCOPe Domain Sequences for d4u7ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u7ja1 c.26.2.0 (A:3-172) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]} ervilaysggldtsvaiswigketgrevvavaidlgqggedmevvrqraldcgavesivi dardefandycvpaiqsnalymdryplvsalsrplivkhlvkaarehggtivahgctgkg ndqvrfevgfaslapdlevlapvrdyawtrekaiafaeennipinvtkrs
Timeline for d4u7ja1: