Lineage for d4tpii_ (4tpi I:)
- Root: SCOPe 2.03
Class g: Small proteins [56992] (90 folds) 
Fold g.8: BPTI-like [57361] (1 superfamily)
disulfide-rich alpha+beta foldSuperfamily g.8.1: BPTI-like [57362] (4 families) 
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species) Species Cow (Bos taurus) [TaxId:9913] [57365] (85 PDB entries) 
Domain d4tpii_: 4tpi I: [44499]
Other proteins in same PDB: d4tpiz_
complexed with ca, so4, val
Details for d4tpii_
PDB Entry: 4tpi (more details), 2.2 Å
PDB Description: the refined 2.2-angstroms (0.22-nm) x-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the arg15 analogue of bovine pancreatic trypsin inhibitor
PDB Compounds: (I:) bovine pancreatic trypsin inhibitorSCOPe Domain Sequences for d4tpii_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tpii_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpcrariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga
SCOPe Domain Coordinates for d4tpii_:
Click to download the PDB-style file with coordinates for d4tpii_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4tpii_:
- d4tpii_ first appeared (with stable ids) in SCOP 1.55
- d4tpii_ appears in SCOPe 2.02
- d4tpii_ appears in SCOPe 2.04
- d4tpii_ appears in the current release, SCOPe 2.08
View in 3D
