Lineage for d4s2pa_ (4s2p A:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.0: automated matches [191512] (1 protein)
not a true familyProtein automated matches [190857] (70 species)
not a true protein
Species Klebsiella pneumoniae [TaxId:573] [225260] (114 PDB entries) 
Domain d4s2pa_: 4s2p A: [269383]
automated match to d1nrfa_
Details for d4s2pa_
PDB Entry: 4s2p (more details), 1.7 Å
PDB Description: crystal structure of unbound oxa-48
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d4s2pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s2pa_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip
SCOPe Domain Coordinates for d4s2pa_:
Click to download the PDB-style file with coordinates for d4s2pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4s2pa_:
- d4s2pa_ first appeared in SCOPe 2.05
- d4s2pa_ appears in SCOPe 2.07
View in 3D
