Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47290] (10 PDB entries) |
Domain d4rs1a_: 4rs1 A: [279338] automated match to d1csga_ complexed with gol, nag |
PDB Entry: 4rs1 (more details), 2.68 Å
SCOPe Domain Sequences for d4rs1a_:
Sequence, based on SEQRES records: (download)
>d4rs1a_ a.26.1.2 (A:) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]} ehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgsltkl kgpltmmashykqhcpptpetscatqiitfesfkenlkdfllvipfdcwepv
>d4rs1a_ a.26.1.2 (A:) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]} ehvnaiqearrllnlsnetvevisemfdlqeptclqtrlelykqglrgsltklkgpltmm ashykqhcpptpetscatqiitfesfkenlkdfllvipfdcwepv
Timeline for d4rs1a_: