Lineage for d4rhca_ (4rhc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2857937Species Acinetobacter baumannii [TaxId:400667] [260436] (4 PDB entries)
  8. 2857974Domain d4rhca_: 4rhc A: [260437]
    Other proteins in same PDB: d4rhcb_, d4rhcc_, d4rhcd_, d4rhce_, d4rhcf_, d4rhcg_, d4rhch_, d4rhci_, d4rhcj_, d4rhck_, d4rhcl_
    automated match to d1uqrc_

Details for d4rhca_

PDB Entry: 4rhc (more details), 2.68 Å

PDB Description: crystal structure of 3-dehydroquinate dehydratase from acinetobacter baumannii at 2.68 a resolution
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4rhca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rhca_ c.23.13.1 (A:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
sstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdr
ihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdk
aigvicglgakgysfaldyaiekiqpsnpn

SCOPe Domain Coordinates for d4rhca_:

Click to download the PDB-style file with coordinates for d4rhca_.
(The format of our PDB-style files is described here.)

Timeline for d4rhca_: