Lineage for d4rhaa_ (4rha A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.7: OmpA-like [103088] (2 families) 
Family d.79.7.0: automated matches [195454] (1 protein)
not a true familyProtein automated matches [195455] (14 species)
not a true protein
Species Salmonella enterica [TaxId:99287] [260790] (1 PDB entry) 
Domain d4rhaa_: 4rha A: [263866]
automated match to d2mqea_
complexed with acy, mpd, so4
Details for d4rhaa_
PDB Entry: 4rha (more details), 1.75 Å
PDB Description: structure of the c-terminal domain of outer-membrane protein ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
PDB Compounds: (A:) outer membrane protein aSCOPe Domain Sequences for d4rhaa_:
Sequence, based on SEQRES records: (download)
>d4rhaa_ d.79.7.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
evqtkhftlksdvlfnfnkstlkpegqqaldqlysqlsnldpkdgsvvvlgftdrigsda
ynqglsekraqsvvdyliskgipsdkisargmgesnpvtgntcdnvkpraalidclapdr
rveievkgvkdvv
Sequence, based on observed residues (ATOM records): (download)
>d4rhaa_ d.79.7.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
evqtkhftlksdvlfnfnkstlkpegqqaldqlysqlsnldpgsvvvlgftdrigsdayn
qglsekraqsvvdyliskgipsdkisargmgesnpvtgntcdnvkpraalidclapdrrv
eievkgvkdvv
SCOPe Domain Coordinates for d4rhaa_:
Click to download the PDB-style file with coordinates for d4rhaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4rhaa_:
- d4rhaa_ first appeared in SCOPe 2.05
- d4rhaa_ appears in SCOPe 2.07
View in 3D
