Lineage for d4rcga1 (4rcg A:8-244)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domainSuperfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) 
Family c.109.1.0: automated matches [227144] (1 protein)
not a true familyProtein automated matches [226847] (5 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:83332] [271217] (3 PDB entries) 
Domain d4rcga1: 4rcg A:8-244 [271222]
Other proteins in same PDB: d4rcga2
automated match to d4wiua1
complexed with gdp, mg, peg
Details for d4rcga1
PDB Entry: 4rcg (more details), 2.6 Å
PDB Description: crystal structure analysis of mtb pepck without mn+2
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]SCOPe Domain Sequences for d4rcga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rcga1 c.109.1.0 (A:8-244) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhk
nsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyv
vpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgapl
epgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg
SCOPe Domain Coordinates for d4rcga1:
Click to download the PDB-style file with coordinates for d4rcga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4rcga1:
- d4rcga1 first appeared in SCOPe 2.05
- d4rcga1 appears in SCOPe 2.07
View in 3D
