Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries) |
Domain d4r3oe_: 4r3o E: [309364] Other proteins in same PDB: d4r3o1_, d4r3o2_, d4r3oc_, d4r3oh_, d4r3oi_, d4r3oj_, d4r3ok_, d4r3ol_, d4r3om_, d4r3on_, d4r3oq_, d4r3ov_, d4r3ow_, d4r3ox_, d4r3oy_, d4r3oz_ automated match to d1irue_ |
PDB Entry: 4r3o (more details), 2.6 Å
SCOPe Domain Sequences for d4r3oe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r3oe_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} ydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssieki veidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeed adpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhk smtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
Timeline for d4r3oe_: