Lineage for d4qfja_ (4qfj A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (2 families) 
can be classified as disulfide-richFamily d.5.1.1: Ribonuclease A-like [54077] (9 proteins) 
Protein automated matches [190061] (7 species)
not a true protein
Species Norway rat (Rattus norvegicus) [TaxId:10116] [259282] (2 PDB entries) 
Domain d4qfja_: 4qfj A: [259283]
automated match to d2bwla_
complexed with acy, zn
Details for d4qfja_
PDB Entry: 4qfj (more details), 2.2 Å
PDB Description: the crystal structure of rat angiogenin-heparin complex
PDB Compounds: (A:) angiogeninSCOPe Domain Sequences for d4qfja_:
Sequence, based on SEQRES records: (download)
>d4qfja_ d.5.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs
pygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesf
Sequence, based on observed residues (ATOM records): (download)
>d4qfja_ d.5.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs
pynlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesf
SCOPe Domain Coordinates for d4qfja_:
Click to download the PDB-style file with coordinates for d4qfja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qfja_:
- d4qfja_ first appeared in SCOPe 2.04
- d4qfja_ appears in SCOPe 2.07
View in 3D
