Lineage for d4pyoa_ (4pyo A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.1: COMT-like [53336] (4 proteins) Protein Catechol O-methyltransferase, COMT [53337] (2 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries) 
Domain d4pyoa_: 4pyo A: [259265]
automated match to d3u81a_
complexed with k, mg, sah
Details for d4pyoa_
PDB Entry: 4pyo (more details), 2.1 Å
PDB Description: Humanized rat COMT bound to SAH, semi-holo form
PDB Compounds: (A:) Catechol O-methyltransferaseSCOPe Domain Sequences for d4pyoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pyoa_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgps
SCOPe Domain Coordinates for d4pyoa_:
Click to download the PDB-style file with coordinates for d4pyoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4pyoa_:
- d4pyoa_ first appeared in SCOPe 2.04
- d4pyoa_ appears in SCOPe 2.07
View in 3D
