Lineage for d4pxvc_ (4pxv C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928808Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2928809Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2928818Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2928819Protein automated matches [234001] (7 species)
    not a true protein
  7. 2928840Species Pteris ryukyuensis [TaxId:367335] [346349] (2 PDB entries)
  8. 2928847Domain d4pxvc_: 4pxv C: [345410]
    automated match to d5k2la_
    complexed with zn

Details for d4pxvc_

PDB Entry: 4pxv (more details), 1.8 Å

PDB Description: crystal structure of lysm domain from pteris ryukyuensis chitinase a
PDB Compounds: (C:) chitinase a

SCOPe Domain Sequences for d4pxvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pxvc_ d.7.1.0 (C:) automated matches {Pteris ryukyuensis [TaxId: 367335]}
cttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk

SCOPe Domain Coordinates for d4pxvc_:

Click to download the PDB-style file with coordinates for d4pxvc_.
(The format of our PDB-style files is described here.)

Timeline for d4pxvc_: