Lineage for d4pwta_ (4pwt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960609Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 2960618Protein automated matches [190318] (2 species)
    not a true protein
  7. 2960628Species Yersinia pestis [TaxId:214092] [238503] (2 PDB entries)
  8. 2960629Domain d4pwta_: 4pwt A: [238504]
    automated match to d1oapa_
    complexed with fmt, pop, so4

Details for d4pwta_

PDB Entry: 4pwt (more details), 1.75 Å

PDB Description: Crystal structure of peptidoglycan-associated outer membrane lipoprotein from Yersinia pestis CO92
PDB Compounds: (A:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d4pwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pwta_ d.79.7.1 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
natengsnlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkv
vveghadergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaaf
aknrravlvy

SCOPe Domain Coordinates for d4pwta_:

Click to download the PDB-style file with coordinates for d4pwta_.
(The format of our PDB-style files is described here.)

Timeline for d4pwta_: