Lineage for d4pt1b_ (4pt1 B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, opened
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) 
the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
Family a.39.2.0: automated matches [191595] (1 protein)
not a true familyProtein automated matches [191085] (10 species)
not a true protein
Species Migratory locust (Locusta migratoria) [TaxId:7004] [268576] (1 PDB entry) 
Domain d4pt1b_: 4pt1 B: [268577]
automated match to d3k1eb_
complexed with pg0
Details for d4pt1b_
PDB Entry: 4pt1 (more details), 1.65 Å
PDB Description: crystal structure of locusta migratoria odorant binding proteins lmigobp1
PDB Compounds: (B:) Odorant-binding protein 1dSCOPe Domain Sequences for d4pt1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pt1b_ a.39.2.0 (B:) automated matches {Migratory locust (Locusta migratoria) [TaxId: 7004]}
nmkltgrimdaakevdhtcrsstgvprdmlhryaegqtvddddfkcylkcimvefnslsd
dgvfvleeelenvppeikeeghrvvhsckhinhdeacetayqihqcykqsdpelyslvvr
afdatigd
SCOPe Domain Coordinates for d4pt1b_:
Click to download the PDB-style file with coordinates for d4pt1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4pt1b_:
- d4pt1b_ first appeared in SCOPe 2.05
- d4pt1b_ appears in SCOPe 2.07
View in 3D
