Class a: All alpha proteins [46456] (290 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
Protein automated matches [237402] (7 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346214] (2 PDB entries) |
Domain d4ppua_: 4ppu A: [345406] automated match to d5w6yb_ complexed with tyr |
PDB Entry: 4ppu (more details), 2.3 Å
SCOPe Domain Sequences for d4ppua_:
Sequence, based on SEQRES records: (download)
>d4ppua_ a.130.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rvdesesltlegirnslirqedsiifgllerakycynadtydptafdmdgfngslveymv kgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaadsininkkiwnmyfrd lvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfqaspeayesaikaqdkd almdmltfptvedaikkrvemktrtygqevkvgmeekeeeeeegneshvykispilvgdl ygdwimpltkevqveyllrrld
>d4ppua_ a.130.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rvdesesltlegirnslirqedsiifgllerakycynadtydptafdmdgfngslveymv kgteklhakvgrfkspdehpffpddlpepmlpplqypkvlhfaadsininkkiwnmyfrd lvprlvkkgddgnygstavcdaiclqclskrihygkfvaeakfqaspeayesaikaqdkd almdmltfptvedaikkrvemktrtygqevkvykispilvgdlygdwimpltkevqveyl lrrld
Timeline for d4ppua_: