Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (16 PDB entries) |
Domain d4pj6a3: 4pj6 A:616-706 [267176] Other proteins in same PDB: d4pj6a1, d4pj6a2, d4pj6a4, d4pj6b1, d4pj6b2, d4pj6b4 automated match to d4p8qa3 complexed with lys, nag, zn |
PDB Entry: 4pj6 (more details), 2.96 Å
SCOPe Domain Sequences for d4pj6a3:
Sequence, based on SEQRES records: (download)
>d4pj6a3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld kksgvinlteevlwvkvninmngyyivhyad
>d4pj6a3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflnmsdtsylwhiplsyvtegrnyskyqsvslldkksgvi nlteevlwvkvninmngyyivhyad
Timeline for d4pj6a3:
View in 3D Domains from other chains: (mouse over for more information) d4pj6b1, d4pj6b2, d4pj6b3, d4pj6b4 |