Lineage for d4p4qa_ (4p4q A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005140Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2005141Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2005323Domain d4p4qa_: 4p4q A: [270329]
    Other proteins in same PDB: d4p4qb_, d4p4qd_
    automated match to d2bcna_
    complexed with hem

Details for d4p4qa_

PDB Entry: 4p4q (more details), 2.01 Å

PDB Description: complex of yeast cytochrome c peroxidase (w191f) with iso-1 cytochrome c
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4p4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p4qa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4p4qa_:

Click to download the PDB-style file with coordinates for d4p4qa_.
(The format of our PDB-style files is described here.)

Timeline for d4p4qa_: