Lineage for d4p49a1 (4p49 A:1-102)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365383Species Chicken (Gallus gallus) [TaxId:9031] [188287] (25 PDB entries)
  8. 2365392Domain d4p49a1: 4p49 A:1-102 [257428]
    automated match to d4ouoa1
    complexed with act, so4

Details for d4p49a1

PDB Entry: 4p49 (more details), 1.4 Å

PDB Description: the structure of a chicken anti-prostate specific antigen scfv
PDB Compounds: (A:) Antibody scFv B8

SCOPe Domain Sequences for d4p49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p49a1 b.1.1.0 (A:1-102) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
altqpssvsanpgetvkitcsgssgsygwyqqkspdsapvtviyqsnqrpsdipsrfsgs
ksgstgtltitgvqaedeavyycggwgssvgmfgagttltvl

SCOPe Domain Coordinates for d4p49a1:

Click to download the PDB-style file with coordinates for d4p49a1.
(The format of our PDB-style files is described here.)

Timeline for d4p49a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p49a2