Lineage for d4p16a1 (4p16 A:1-61)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178692Family d.15.1.9: Viral protease ubiquitin-like domain [310647] (1 protein)
    N-terminal part of Pfam PF08715
  6. 2178693Protein Papain-like protease PLpro, ubiquitin-like domain [310794] (2 species)
  7. 2178694Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311053] (1 PDB entry)
  8. 2178695Domain d4p16a1: 4p16 A:1-61 [307967]
    Other proteins in same PDB: d4p16a2
    complexed with zn

Details for d4p16a1

PDB Entry: 4p16 (more details), 2.5 Å

PDB Description: crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus
PDB Compounds: (A:) ORF1a

SCOPe Domain Sequences for d4p16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p16a1 d.15.1.9 (A:1-61) Papain-like protease PLpro, ubiquitin-like domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
qltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnl
t

SCOPe Domain Coordinates for d4p16a1:

Click to download the PDB-style file with coordinates for d4p16a1.
(The format of our PDB-style files is described here.)

Timeline for d4p16a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p16a2