Lineage for d4oz4b2 (4oz4 B:113-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753296Domain d4oz4b2: 4oz4 B:113-218 [268594]
    Other proteins in same PDB: d4oz4a1, d4oz4a2, d4oz4b1, d4oz4h1, d4oz4h2, d4oz4l1
    automated match to d3hzma2

Details for d4oz4b2

PDB Entry: 4oz4 (more details), 3 Å

PDB Description: x-ray structure of the dc8e8 fab apo-form crystallized at ph 8.5 and refined to 3.0 a.
PDB Compounds: (B:) Fab of monoclonal antibody, light chain

SCOPe Domain Sequences for d4oz4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oz4b2 b.1.1.2 (B:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4oz4b2:

Click to download the PDB-style file with coordinates for d4oz4b2.
(The format of our PDB-style files is described here.)

Timeline for d4oz4b2: