Lineage for d4oy9a1 (4oy9 A:1-101)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.6: Cadherin-like [49313] (4 families) 
Family b.1.6.0: automated matches [191376] (1 protein)
not a true familyProtein automated matches [190458] (4 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries) 
Domain d4oy9a1: 4oy9 A:1-101 [270989]
automated match to d1ff5a1
complexed with ca
Details for d4oy9a1
PDB Entry: 4oy9 (more details), 1.62 Å
PDB Description: crystal structure of human p-cadherin ec1-ec2 in closed conformation
PDB Compounds: (A:) Cadherin-3SCOPe Domain Sequences for d4oy9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oy9a1 b.1.6.0 (A:1-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwl
llnkpldreeiakyelfghavsengasvedpmnisiivtdq
SCOPe Domain Coordinates for d4oy9a1:
Click to download the PDB-style file with coordinates for d4oy9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4oy9a1:
- d4oy9a1 first appeared in SCOPe 2.05
- d4oy9a1 appears in SCOPe 2.07
View in 3D
