Lineage for d4oulb_ (4oul B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779444Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 1779445Protein automated matches [190873] (3 species)
    not a true protein
  7. 1779446Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)
  8. 1779462Domain d4oulb_: 4oul B: [260722]
    automated match to d2wnve_
    complexed with ca, gol

Details for d4oulb_

PDB Entry: 4oul (more details), 1.95 Å

PDB Description: crystal structure of human caprin-2 c1q domain
PDB Compounds: (B:) Caprin-2

SCOPe Domain Sequences for d4oulb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oulb_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
ystfsgyllyqd

SCOPe Domain Coordinates for d4oulb_:

Click to download the PDB-style file with coordinates for d4oulb_.
(The format of our PDB-style files is described here.)

Timeline for d4oulb_: