Lineage for d4ohjb2 (4ohj B:134-236)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894723Protein automated matches [226944] (2 species)
    not a true protein
  7. 1894724Species Staphylococcus aureus [TaxId:1280] [225595] (2 PDB entries)
  8. 1894727Domain d4ohjb2: 4ohj B:134-236 [236650]
    Other proteins in same PDB: d4ohja1, d4ohjb1
    automated match to d1aw7a2

Details for d4ohjb2

PDB Entry: 4ohj (more details), 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohjb2 d.15.6.1 (B:134-236) automated matches {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkygpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaeinge

SCOPe Domain Coordinates for d4ohjb2:

Click to download the PDB-style file with coordinates for d4ohjb2.
(The format of our PDB-style files is described here.)

Timeline for d4ohjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ohjb1