Lineage for d4oh0a_ (4oh0 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014133Species Acinetobacter baumannii [TaxId:470] [194613] (64 PDB entries)
  8. 3014141Domain d4oh0a_: 4oh0 A: [254060]
    automated match to d4k0xa_
    complexed with cl

Details for d4oh0a_

PDB Entry: 4oh0 (more details), 1.3 Å

PDB Description: Crystal structure of OXA-58 carbapenemase
PDB Compounds: (A:) Beta-lactamase OXA-58

SCOPe Domain Sequences for d4oh0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oh0a_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
siidqnvqalfneisadavfvtydgqnikkygthldraktayipastfkianaliglenh
katsteifkwdgkprffkawdkdftlgeamqastvpvyqelarrigpslmqselqrigyg
nmqigtevdqfwlkgpltitpiqevkfvydlaqgqlpfkpevqqqvkemlyverrgenrl
yaksgwgmavdpqvgwyvgfvekadgqvvafalnmqmkagddialrkqlsldvldklgvf
hyl

SCOPe Domain Coordinates for d4oh0a_:

Click to download the PDB-style file with coordinates for d4oh0a_.
(The format of our PDB-style files is described here.)

Timeline for d4oh0a_: