Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [311407] (3 PDB entries) |
Domain d4offa_: 4off A: [307857] automated match to d4ku8c_ complexed with so4 |
PDB Entry: 4off (more details), 1.89 Å
SCOPe Domain Sequences for d4offa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4offa_ b.82.3.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} sidynnkksiikkmyifryltdkqcnllieafrttryeegdyiiqegevgsrfyiiknge veivknkkrlrtlgkndyfgerallydeprtasviskvnnvecwfvdksvflqiiqgpml ahle
Timeline for d4offa_: