Lineage for d4o5md2 (4o5m D:229-382)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708514Species Brucella suis [TaxId:204722] [230320] (1 PDB entry)
  8. 2708518Domain d4o5md2: 4o5m D:229-382 [230321]
    Other proteins in same PDB: d4o5ma1, d4o5ma3, d4o5mb1, d4o5mb3, d4o5mc1, d4o5mc3, d4o5md1, d4o5md3
    automated match to d1buca1
    complexed with ca, pg5

Details for d4o5md2

PDB Entry: 4o5m (more details), 2.2 Å

PDB Description: X-ray Crystal Structure of Isovaleryl-CoA Dehydrogenase from Brucella suis
PDB Compounds: (D:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d4o5md2:

Sequence, based on SEQRES records: (download)

>d4o5md2 a.29.3.0 (D:229-382) automated matches {Brucella suis [TaxId: 204722]}
gkgvnvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladm
yvtfnasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyp
tgrllrdaklyeigagtseirrmligrelfqetr

Sequence, based on observed residues (ATOM records): (download)

>d4o5md2 a.29.3.0 (D:229-382) automated matches {Brucella suis [TaxId: 204722]}
gkgvnvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladm
yvtfnasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngdyptgr
llrdaklyeirmligrelfqetr

SCOPe Domain Coordinates for d4o5md2:

Click to download the PDB-style file with coordinates for d4o5md2.
(The format of our PDB-style files is described here.)

Timeline for d4o5md2: