Lineage for d4o5md1 (4o5m D:-3-228)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691655Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1691656Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1691797Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1691798Protein automated matches [226934] (17 species)
    not a true protein
  7. 1691810Species Brucella suis [TaxId:204722] [230318] (1 PDB entry)
  8. 1691814Domain d4o5md1: 4o5m D:-3-228 [230319]
    Other proteins in same PDB: d4o5ma2, d4o5mb2, d4o5mc2, d4o5md2
    automated match to d1buca2
    complexed with ca, pg5

Details for d4o5md1

PDB Entry: 4o5m (more details), 2.2 Å

PDB Description: X-ray Crystal Structure of Isovaleryl-CoA Dehydrogenase from Brucella suis
PDB Compounds: (D:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d4o5md1:

Sequence, based on SEQRES records: (download)

>d4o5md1 e.6.1.0 (D:-3-228) automated matches {Brucella suis [TaxId: 204722]}
hhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitap
edyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklis
gehvgalamsepgagsdvvsmklaaekrgdryvlngnkmwitngpdadvlvvyaktdlsa
gprgisafiiekgfkgfstaqkldklgmrgsntcelvfedcevpaenllgte

Sequence, based on observed residues (ATOM records): (download)

>d4o5md1 e.6.1.0 (D:-3-228) automated matches {Brucella suis [TaxId: 204722]}
hhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitap
edyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklis
gehvgalamsmklaaekrgdryvlngnkmwitngpdadvlvvyaktgisafiiekgfkgf
staqkldklgmrgsntcelvfedcevpaenllgte

SCOPe Domain Coordinates for d4o5md1:

Click to download the PDB-style file with coordinates for d4o5md1.
(The format of our PDB-style files is described here.)

Timeline for d4o5md1: