Lineage for d4nyza_ (4nyz A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1953148Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 1953149Protein automated matches [226844] (5 species)
    not a true protein
  7. 1953176Species Mengo virus [TaxId:12107] [237860] (3 PDB entries)
  8. 1953177Domain d4nyza_: 4nyz A: [237861]
    automated match to d1rdra_
    complexed with gln, gol, mg

Details for d4nyza_

PDB Entry: 4nyz (more details), 2.15 Å

PDB Description: The EMCV 3Dpol structure with altered motif A conformation at 2.15A resolution
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d4nyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nyza_ e.8.1.0 (A:) automated matches {Mengo virus [TaxId: 12107]}
galerlpdgprihvprktalrptvarqvfqpafapavlskfdprtdadvdevafskhtsn
qetlppvfrmvareyanrvfallgrdngrlsvkqaldglegmdpmdkntspglpyttlgm
rrtdvvdwetatlipfaaerlekmnnkdfsdivyqtflkdelrpiekvqaaktrivdvpp
fehcilgrqllgkfaskfqtqpglelgsaigcdpdvhwtafgvamqgfervydvdysnfd
sthsvavfrllaeeffseengfdplvkdyleslaiskhayeekrylitgglpsgcaatsm
lntimnniiiraglyltyknfefddvkvlsygddllvatnyqlnfdrvrtslaktgykit
panktstfplestledvvflkrkfkkegplyrpvmnrealeamlsyyrpgtlsekltsit
mlavhsgkqeydrlfapfrevgvivptfesveyrwrslfw

SCOPe Domain Coordinates for d4nyza_:

Click to download the PDB-style file with coordinates for d4nyza_.
(The format of our PDB-style files is described here.)

Timeline for d4nyza_: