Lineage for d4nstb2 (4nst B:158-265)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718713Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2718714Protein automated matches [227124] (1 species)
    not a true protein
  7. 2718715Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)
  8. 2718719Domain d4nstb2: 4nst B:158-265 [238029]
    Other proteins in same PDB: d4nsta_, d4nstc_
    automated match to d2pk2a1
    protein/RNA complex; complexed with adp, af3, edo, mg

Details for d4nstb2

PDB Entry: 4nst (more details), 2.2 Å

PDB Description: Crystal structure of human Cdk12/Cyclin K in complex with ADP-aluminum fluoride
PDB Compounds: (B:) cyclin-k

SCOPe Domain Sequences for d4nstb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nstb2 a.74.1.0 (B:158-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgkqqm

SCOPe Domain Coordinates for d4nstb2:

Click to download the PDB-style file with coordinates for d4nstb2.
(The format of our PDB-style files is described here.)

Timeline for d4nstb2:

2718719
d4nstb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4nstb1