Lineage for d4nqga_ (4nqg A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
Duplication: made with two pairs of EF-hands
Protein automated matches [190064] (21 species)
not a true proteinSpecies Mitrocoma cellularia [TaxId:31874] [261220] (1 PDB entry) 
Domain d4nqga_: 4nqg A: [261221]
automated match to d4n1ga_
complexed with czh
Details for d4nqga_
PDB Entry: 4nqg (more details), 1.3 Å
PDB Description: Crystal Structure of Ca(2+)-regulated photoprotein mitrocomin from Jellyfish Mitrocoma cellularia at 1.3 Angstrom resolution
PDB Compounds: (A:) MitrocominSCOPe Domain Sequences for d4nqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nqga_ a.39.1.5 (A:) automated matches {Mitrocoma cellularia [TaxId: 31874]}
smgsryavkldtdfdnpkwiarhkhmfnfldinsngqinlnemvhkasniickklgatee
qtrrhqkcvedffggagleydkdttwpeyiegwkrlaktelerhsknrvtlirlwgdalf
diidkdgngsvsldewiqythcagiqqsrgqceatfahcdldgdgkldvdemtrqhlgfw
ysvdstceglyggavpy
SCOPe Domain Coordinates for d4nqga_:
Click to download the PDB-style file with coordinates for d4nqga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nqga_:
- d4nqga_ first appeared in SCOPe 2.04
- d4nqga_ appears in SCOPe 2.07
View in 3D
