Lineage for d4nmub_ (4nmu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879042Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [194451] (2 PDB entries)
  8. 2879045Domain d4nmub_: 4nmu B: [229952]
    Other proteins in same PDB: d4nmua2, d4nmuc2
    automated match to d1st9a_
    complexed with acy, edo, gol, mg, peg

Details for d4nmub_

PDB Entry: 4nmu (more details), 1.35 Å

PDB Description: Crystal Structure of Thiol-disulfide Oxidoreductase from Bacillus str. 'Ames Ancestor'
PDB Compounds: (B:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d4nmub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nmub_ c.47.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kmqigkeapnfvvtdlegkkielkdlkgkgvflnfwgtwckpcekempymnelypkykek
gveiialdadetdiavknfvnqyglkfpvaidkgqkiigtygvgplptsflidkdgkvve
qiigeqtkeqlegylkkitp

SCOPe Domain Coordinates for d4nmub_:

Click to download the PDB-style file with coordinates for d4nmub_.
(The format of our PDB-style files is described here.)

Timeline for d4nmub_: