Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [194451] (2 PDB entries) |
Domain d4nmub_: 4nmu B: [229952] Other proteins in same PDB: d4nmua2, d4nmuc2 automated match to d1st9a_ complexed with acy, edo, gol, mg, peg |
PDB Entry: 4nmu (more details), 1.35 Å
SCOPe Domain Sequences for d4nmub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nmub_ c.47.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kmqigkeapnfvvtdlegkkielkdlkgkgvflnfwgtwckpcekempymnelypkykek gveiialdadetdiavknfvnqyglkfpvaidkgqkiigtygvgplptsflidkdgkvve qiigeqtkeqlegylkkitp
Timeline for d4nmub_: