Lineage for d4nkrb_ (4nkr B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849674Species Bacillus subtilis [TaxId:655816] [261215] (2 PDB entries)
  8. 1849676Domain d4nkrb_: 4nkr B: [263151]
    automated match to d4nkra_
    complexed with so4

Details for d4nkrb_

PDB Entry: 4nkr (more details), 2.41 Å

PDB Description: the crystal structure of bacillus subtilis mobb
PDB Compounds: (B:) Molybdopterin-guanine dinucleotide biosynthesis protein B

SCOPe Domain Sequences for d4nkrb_:

Sequence, based on SEQRES records: (download)

>d4nkrb_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]}
fpivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegkdtdryqaag
advtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvvilsekedle
alktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkges

Sequence, based on observed residues (ATOM records): (download)

>d4nkrb_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]}
fpivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlt
arrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkk
ehmtehqglpifhaddpvavdlvlsqlkges

SCOPe Domain Coordinates for d4nkrb_:

Click to download the PDB-style file with coordinates for d4nkrb_.
(The format of our PDB-style files is described here.)

Timeline for d4nkrb_: