Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Artificial gene [TaxId:32630] [238445] (2 PDB entries) |
Domain d4n6ta_: 4n6t A: [238446] automated match to d2w9pa_ |
PDB Entry: 4n6t (more details), 1.75 Å
SCOPe Domain Sequences for d4n6ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n6ta_ d.17.1.0 (A:) automated matches {Artificial gene [TaxId: 32630]} ensleieelarfavdehnkkenallefvrvvkakeqvvagtmyyltleakdggkkklyea kvwvkpwenfkelqefkpv
Timeline for d4n6ta_: