Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
Protein Thermolysin [63414] (3 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries) Uniprot P00800 |
Domain d4n4ee_: 4n4e E: [238221] automated match to d1kkka_ complexed with 2g6, ca, dms, gol, zn |
PDB Entry: 4n4e (more details), 1.13 Å
SCOPe Domain Sequences for d4n4ee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n4ee_ d.92.1.2 (E:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]} itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d4n4ee_: