Lineage for d4n1va_ (4n1v A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
core: 4 helices; bundle, partly opened, capped with a beta-sheetSuperfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) 
dimer of identical subunitsFamily a.55.1.0: automated matches [191573] (1 protein)
not a true familyProtein automated matches [191007] (5 species)
not a true protein
Species Spiroplasma melliferum [TaxId:570509] [260909] (2 PDB entries) 
Domain d4n1va_: 4n1v A: [260910]
automated match to d1owfa_
Details for d4n1va_
PDB Entry: 4n1v (more details), 1.36 Å
PDB Description: structure of dna-binding protein hu from micoplasma spiroplasma melliferum
PDB Compounds: (A:) DNA-binding protein HU-betaSCOPe Domain Sequences for d4n1va_:
Sequence, based on SEQRES records: (download)
>d4n1va_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]}
hhmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
ardgrnpstgetikipasksakfkagkqlktdlnn
Sequence, based on observed residues (ATOM records): (download)
>d4n1va_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]}
hhmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
ardgrntgetikipasksakfkagkqlktdlnn
SCOPe Domain Coordinates for d4n1va_:
Click to download the PDB-style file with coordinates for d4n1va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4n1va_:
- d4n1va_ first appeared in SCOPe 2.04
- d4n1va_ is called d4n1va1 in SCOPe 2.06
- d4n1va_ appears in the current release, SCOPe 2.08, called d4n1va1
View in 3D