Lineage for d4n1ga_ (4n1g A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
Duplication: made with two pairs of EF-hands
Protein automated matches [190064] (21 species)
not a true protein
Species Obelia longissima [TaxId:32570] [237068] (4 PDB entries) 
Domain d4n1ga_: 4n1g A: [237069]
automated match to d1uhka_
complexed with ca, cei; mutant
Details for d4n1ga_
PDB Entry: 4n1g (more details), 1.5 Å
PDB Description: Crystal Structure of Ca(2+)- discharged F88Y obelin mutant from Obelia longissima at 1.50 Angstrom resolution
PDB Compounds: (A:) obelinSCOPe Domain Sequences for d4n1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n1ga_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]}
askyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglygngvp
SCOPe Domain Coordinates for d4n1ga_:
Click to download the PDB-style file with coordinates for d4n1ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4n1ga_:
- d4n1ga_ first appeared in SCOPe 2.03
- d4n1ga_ appears in SCOPe 2.05
- d4n1ga_ appears in SCOPe 2.07
- d4n1ga_ appears in the current release, SCOPe 2.08
View in 3D
