Lineage for d4mzeb_ (4mze B:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein automated matches [193245] (7 species)
not a true protein
Species Human parainfluenza 3 virus [TaxId:11217] [228816] (2 PDB entries) 
Domain d4mzeb_: 4mze B: [228824]
automated match to d1v3ea_
complexed with ca, edo, nag, peg, po4, so4; mutant
Details for d4mzeb_
PDB Entry: 4mze (more details), 1.8 Å
PDB Description: crystal structure of hpiv3 hemagglutinin-neuraminidase, h552q/q559r mutant
PDB Compounds: (B:) hemagglutinin-neuraminidaseSCOPe Domain Sequences for d4mzeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mzeb_ b.68.1.1 (B:) automated matches {Human parainfluenza 3 virus [TaxId: 11217]}
rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
srvnpvityststervnelairnktlsagytttscithynkgycfhiveinqksldtfrp
mlfkteipkscs
SCOPe Domain Coordinates for d4mzeb_:
Click to download the PDB-style file with coordinates for d4mzeb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mzeb_:
- d4mzeb_ is new in SCOPe 2.03-stable
- d4mzeb_ appears in SCOPe 2.04
- d4mzeb_ appears in the current release, SCOPe 2.08
View in 3D
