Lineage for d4myoa_ (4myo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806519Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806520Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1806555Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 1806622Protein automated matches [190704] (4 species)
    not a true protein
  7. 1806634Species Staphylococcus aureus [TaxId:1280] [193357] (3 PDB entries)
  8. 1806641Domain d4myoa_: 4myo A: [228418]
    automated match to d4husb_
    complexed with cl, mg, so4

Details for d4myoa_

PDB Entry: 4myo (more details), 2.7 Å

PDB Description: Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus
PDB Compounds: (A:) Virginiamycin A acetyltransferase

SCOPe Domain Sequences for d4myoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4myoa_ b.81.1.3 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
wwnldmkiinenlpfiingdiemlkrkrkll

SCOPe Domain Coordinates for d4myoa_:

Click to download the PDB-style file with coordinates for d4myoa_.
(The format of our PDB-style files is described here.)

Timeline for d4myoa_: