Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins) this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain |
Protein automated matches [190704] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [193357] (3 PDB entries) |
Domain d4myoa_: 4myo A: [228418] automated match to d4husb_ complexed with cl, mg, so4 |
PDB Entry: 4myo (more details), 2.7 Å
SCOPe Domain Sequences for d4myoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4myoa_ b.81.1.3 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq wwnldmkiinenlpfiingdiemlkrkrkll
Timeline for d4myoa_: