Lineage for d4mxic_ (4mxi C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852912Species Staphylococcus aureus [TaxId:93061] [189958] (8 PDB entries)
  8. 2852977Domain d4mxic_: 4mxi C: [235694]
    automated match to d4mxia_

Details for d4mxic_

PDB Entry: 4mxi (more details), 2.3 Å

PDB Description: ClpP Ser98dhA
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4mxic_:

Sequence, based on SEQRES records: (download)

>d4mxic_ c.14.1.1 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqplggaqgqateiei
aanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpet

Sequence, based on observed residues (ATOM records): (download)

>d4mxic_ c.14.1.1 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqplteieiaanhilk
treklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpet

SCOPe Domain Coordinates for d4mxic_:

Click to download the PDB-style file with coordinates for d4mxic_.
(The format of our PDB-style files is described here.)

Timeline for d4mxic_: