Lineage for d4mu8a_ (4mu8 A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the coreFamily a.3.1.1: monodomain cytochrome c [46627] (16 proteins) 
Protein Mitochondrial cytochrome c [46642] (7 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (71 PDB entries)
Uniprot P00044
Domain d4mu8a_: 4mu8 A: [257106]
automated match to d2bcnb_
complexed with gol, hem, so4, tbu
Details for d4mu8a_
PDB Entry: 4mu8 (more details), 1.45 Å
PDB Description: crystal structure of an oxidized form of yeast iso-1-cytochrome c at ph 8.8
PDB Compounds: (A:) Cytochrome c iso-1SCOPe Domain Sequences for d4mu8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mu8a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
SCOPe Domain Coordinates for d4mu8a_:
Click to download the PDB-style file with coordinates for d4mu8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mu8a_:
- d4mu8a_ first appeared in SCOPe 2.04
- d4mu8a_ appears in SCOPe 2.05
- d4mu8a_ appears in SCOPe 2.07
- d4mu8a_ appears in the current release, SCOPe 2.08
View in 3D
