Lineage for d4mqgb_ (4mqg B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Hemoglobin, beta-chain [46500] (26 species) 
Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries)
Uniprot P68871
Domain d4mqgb_: 4mqg B: [228116]
Other proteins in same PDB: d4mqga_
automated match to d1irdb_
complexed with cmo, hem
Details for d4mqgb_
PDB Entry: 4mqg (more details), 1.68 Å
PDB Description: Structure of Carbonmonoxy Adult Hemoglobin Bristol-Alesha alphawtbetaV67M
PDB Compounds: (B:) Hemoglobin subunit betaSCOPe Domain Sequences for d4mqgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkmlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh
SCOPe Domain Coordinates for d4mqgb_:
Click to download the PDB-style file with coordinates for d4mqgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mqgb_:
- d4mqgb_ first appeared in SCOPe 2.03
- d4mqgb_ appears in SCOPe 2.07
View in 3D
