Lineage for d4mlva1 (4mlv A:1-218)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915250Species Bacillus megaterium [TaxId:1404] [238213] (5 PDB entries)
  8. 2915251Domain d4mlva1: 4mlv A:1-218 [253804]
    Other proteins in same PDB: d4mlva2, d4mlva3
    automated match to d4mlqa1
    complexed with 29p, acy, dpm

Details for d4mlva1

PDB Entry: 4mlv (more details), 1.46 Å

PDB Description: Crystal Structure of Bacillus megaterium porphobilinogen deaminase
PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d4mlva1:

Sequence, based on SEQRES records: (download)

>d4mlva1 c.94.1.0 (A:1-218) automated matches {Bacillus megaterium [TaxId: 1404]}
mrkiivgsrrsklaltqtkwvieqlkkqglpfefeikemvtkgdqilnvtlskvggkglf
vkeieqamldkeidmavhsmkdmpavlpegltigciplredhrdaliskngerfeelpsg
avigtsslrrgaqllsmrsdieikwirgnidtrleklknedydaiilaaaglsrmgwskd
tvtqylepeisvpavgqgalaiecrendhellsllqal

Sequence, based on observed residues (ATOM records): (download)

>d4mlva1 c.94.1.0 (A:1-218) automated matches {Bacillus megaterium [TaxId: 1404]}
mrkiivgsrrsklaltqtkwvieqlkkqglpfefeikemvkeieqamldkeidmavhsmk
dmpavlpegltigciplredhrdaliskngerfeelpsgavigtsslrrgaqllsmrsdi
eikwirgnidtrleklknedydaiilaaaglsrmgwskdtvtqylepeisvpavgqgala
iecrendhellsllqal

SCOPe Domain Coordinates for d4mlva1:

Click to download the PDB-style file with coordinates for d4mlva1.
(The format of our PDB-style files is described here.)

Timeline for d4mlva1: