Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries) |
Domain d4mi2b_: 4mi2 B: [227990] automated match to d3moya_ |
PDB Entry: 4mi2 (more details), 2.3 Å
SCOPe Domain Sequences for d4mi2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mi2b_ c.14.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]} aavaysvnhagvaaivldrpeasnaldrtmktellqallaaggdpavravvmsaagknfc vgqdlaehvealrddpahamdtvrehynpvlealdaikvpvvvaingacvgaglglalga diriagqrakfgtaftgiglaadsalsaslprligasratamfllgdtidaptahtwglv hevvdegspadvansvagrlaggptaafsevkellrrnavaplgdvlereasaqqrlgas rdhsaaveaflakdkpvfvgr
Timeline for d4mi2b_: