Lineage for d4mdpa_ (4mdp A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820500Species Humicola grisea [TaxId:5528] [257077] (2 PDB entries)
  8. 1820501Domain d4mdpa_: 4mdp A: [257078]
    automated match to d4atla_
    complexed with bgc, gol, peg, po4

Details for d4mdpa_

PDB Entry: 4mdp (more details), 2.05 Å

PDB Description: crystal structure of a gh1 beta-glucosidase from the fungus humicola insolens in complex with glucose
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d4mdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mdpa_ c.1.8.0 (A:) automated matches {Humicola grisea [TaxId: 5528]}
smslppdfkwgfataayqiegsvnedgrgpsiwdtfcaipgkiadgssgavacdsykrtk
ediallkelgansyrfsiswsriiplggrndpinqkgidhyvkfvddlieagitpfitlf
hwdlpdaldkryggflnkeefaadfenyarimfkaipkckhwitfnepwcsailgyntgy
fapghtsdrskspvgdsarepwivghniliaharavkayredfkptqggeigitlngdat
lpwdpedpadieacdrkiefaiswfadpiyfgkypdsmrkqlgdrlpeftpeevalvkgs
ndfygmnhytanyikhktgvppeddflgnletlfynkygdcigpetqsfwlrphaqgfrd
llnwlskrygypkiyvtengtslkgendmpleqvleddfrvkyfndyvramaaavaedgc
nvrgylawslldnfewaegyetrfgvtyvdyandqkrypkksakslkplfdslirke

SCOPe Domain Coordinates for d4mdpa_:

Click to download the PDB-style file with coordinates for d4mdpa_.
(The format of our PDB-style files is described here.)

Timeline for d4mdpa_: