Lineage for d4mcoc_ (4mco C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879919Protein TRAP dicarboxylate transporter [267666] (2 species)
  7. 1879922Species Rhodoferax ferrireducens [TaxId:338969] [267751] (2 PDB entries)
  8. 1879925Domain d4mcoc_: 4mco C: [266730]
    complexed with epe, mli

Details for d4mcoc_

PDB Entry: 4mco (more details), 1.6 Å

PDB Description: Crystal structure of a TRAP periplasmic solute binding protein from Rhodoferax ferrireducens (Rfer_1840), target EFI-510211, with bound malonate
PDB Compounds: (C:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4mcoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcoc_ c.94.1.1 (C:) TRAP dicarboxylate transporter {Rhodoferax ferrireducens [TaxId: 338969]}
salkishqfpggtikegdfrdrlvrnfaaevekrskgamkfeiypgsslmktnaqfssmr
kgaldmaliplsyaggevpelniglmpglvvsyeqayswktkpvgieltrvlqekgivli
swiwqaggvasrgkpvvepedakgmkirggsremdmilkdagaavvslpsneiyaamqtg
amdaamtsstsfisfrleevakalttgrtgaywfmfeplmmskaifdklpkdqrdmlmtv
gaemekfaleaakkddidvaavyqkagakvvdlsdgtikkwqdiarktawkdygaknegc
akllalaqqtlaenlyfq

SCOPe Domain Coordinates for d4mcoc_:

Click to download the PDB-style file with coordinates for d4mcoc_.
(The format of our PDB-style files is described here.)

Timeline for d4mcoc_: