Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins) |
Protein TRAP dicarboxylate transporter [267666] (2 species) |
Species Rhodoferax ferrireducens [TaxId:338969] [267751] (2 PDB entries) |
Domain d4mcoc_: 4mco C: [266730] complexed with epe, mli |
PDB Entry: 4mco (more details), 1.6 Å
SCOPe Domain Sequences for d4mcoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcoc_ c.94.1.1 (C:) TRAP dicarboxylate transporter {Rhodoferax ferrireducens [TaxId: 338969]} salkishqfpggtikegdfrdrlvrnfaaevekrskgamkfeiypgsslmktnaqfssmr kgaldmaliplsyaggevpelniglmpglvvsyeqayswktkpvgieltrvlqekgivli swiwqaggvasrgkpvvepedakgmkirggsremdmilkdagaavvslpsneiyaamqtg amdaamtsstsfisfrleevakalttgrtgaywfmfeplmmskaifdklpkdqrdmlmtv gaemekfaleaakkddidvaavyqkagakvvdlsdgtikkwqdiarktawkdygaknegc akllalaqqtlaenlyfq
Timeline for d4mcoc_: