Lineage for d4mafc2 (4maf C:219-450)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590854Species Soybean (Glycine max) [TaxId:3847] [237649] (1 PDB entry)
  8. 1590857Domain d4mafc2: 4maf C:219-450 [237651]
    Other proteins in same PDB: d4mafa1, d4mafb1, d4mafc1, d4mafd1, d4mafe1, d4maff1, d4mafg1, d4mafh1
    automated match to d1g8fa2
    complexed with adx

Details for d4mafc2

PDB Entry: 4maf (more details), 2.48 Å

PDB Description: Soybean ATP Sulfurylase
PDB Compounds: (C:) ATP sulfurylase

SCOPe Domain Sequences for d4mafc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mafc2 c.26.1.0 (C:219-450) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gldhfrlsptqlraeftrrnadavfafqlrnpvhnghallmtdtrkrllemgyknpvlll
hplggytkaddvpldwrmkqhekvledgvldpettvvsifpspmhyagptevqwhakari
naganfyivgrdpagmshpvekrdlydadhgkkvlsmapglerlnilpfrvaaydktqgk
maffdpsrpqdflfisgtkmrtlarnkesppdgfmcpggwkvlvdyydslvl

SCOPe Domain Coordinates for d4mafc2:

Click to download the PDB-style file with coordinates for d4mafc2.
(The format of our PDB-style files is described here.)

Timeline for d4mafc2: