SCOPe 2.06: Domain d4mafa2: 4maf A:219-449

Lineage for d4mafa2 (4maf A:219-449)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)
Family c.26.1.0: automated matches [191377] (1 protein)
not a true family
Protein automated matches [190459] (50 species)
not a true protein
Species Soybean (Glycine max) [TaxId:3847] [237649] (1 PDB entry)

Domain d4mafa2: 4maf A:219-449 [237650]
Other proteins in same PDB: d4mafa1, d4mafb1, d4mafb3, d4mafc1, d4mafc3, d4mafd1, d4mafe1, d4mafe3, d4maff1, d4mafg1, d4mafg3, d4mafh1
automated match to d1g8fa2
complexed with adx

Details for d4mafa2

PDB Entry: 4maf (more details), 2.48 Å

PDB Description: Soybean ATP Sulfurylase

PDB Compounds: (A:) ATP sulfurylase

SCOPe Domain Sequences for d4mafa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mafa2 c.26.1.0 (A:219-449) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gldhfrlsptqlraeftrrnadavfafqlrnpvhnghallmtdtrkrllemgyknpvlll
hplggytkaddvpldwrmkqhekvledgvldpettvvsifpspmhyagptevqwhakari
naganfyivgrdpagmshpvekrdlydadhgkkvlsmapglerlnilpfrvaaydktqgk
maffdpsrpqdflfisgtkmrtlarnkesppdgfmcpggwkvlvdyydslv

SCOPe Domain Coordinates for d4mafa2:

Click to download the PDB-style file with coordinates for d4mafa2.
(The format of our PDB-style files is described here.)

Timeline for d4mafa2: