Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (40 species) not a true protein |
Species Staphylococcus epidermidis [TaxId:176280] [256363] (1 PDB entry) |
Domain d4m7oa_: 4m7o A: [253771] automated match to d1n2za_ |
PDB Entry: 4m7o (more details), 2.02 Å
SCOPe Domain Sequences for d4m7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m7oa_ c.92.2.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} kkyhriislipsnteilyrlgigedivgvstvddypkdvkkgkkqfdamnlnkeelikak pdlilahesqknsagkvlkslkdkgvkvvyvkdaqsidetydtfksigqltdrekqakel vdetkhnvdkiinsvpkhhkkqevfmevsskpdiytagkdtffndmlekldaknsfddvk gwksvskesiikrnpdilistegksksdyiemikkrggfdkinavkntrietvdgdevsr pgprideglkdlrddiyk
Timeline for d4m7oa_: