Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (29 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [188322] (6 PDB entries) |
Domain d4m35c_: 4m35 C: [237289] automated match to d2z90a_ complexed with cl, fe2, mg; mutant |
PDB Entry: 4m35 (more details), 2.05 Å
SCOPe Domain Sequences for d4m35c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m35c_ a.25.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt irrvddavdaedpstadlldglidglekqawlirsenrkv
Timeline for d4m35c_: