SCOPe 2.04: Domain d4m1dm1: 4m1d M:2-106A

Lineage for d4m1dm1 (4m1d M:2-106A)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (19 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
Domain d4m1dm1: 4m1d M:2-106A [227799]
Other proteins in same PDB: d4m1dh1, d4m1dh2, d4m1di1, d4m1di2
automated match to d1yuha1
complexed with gol

Details for d4m1dm1

PDB Entry: 4m1d (more details), 1.8 Å

PDB Description: Crystal structure of anti-HIV-1 Fab 447-52D in complex with V3 cyclic peptide MN

PDB Compounds: (M:) Fab mAb 447-52D Light Chain

SCOPe Domain Sequences for d4m1dm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1dm1 b.1.1.0 (M:2-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgipd
rfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvl

SCOPe Domain Coordinates for d4m1dm1:

Click to download the PDB-style file with coordinates for d4m1dm1.
(The format of our PDB-style files is described here.)

Timeline for d4m1dm1: